Brand: | Abnova |
Reference: | H00121340-M01 |
Product name: | SP7 monoclonal antibody (M01), clone 2G6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SP7. |
Clone: | 2G6 |
Isotype: | IgG2a Kappa |
Gene id: | 121340 |
Gene name: | SP7 |
Gene alias: | MGC126598|OSX|osterix |
Gene description: | Sp7 transcription factor |
Genbank accession: | NM_152860 |
Immunogen: | SP7 (NP_690599, 87 a.a. ~ 162 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GYANDYPPFSHSFPGPTGTQDPGLLVPKGHSSSDCLPSVYTSLDMTHPYGSWYKAGIHAGISPGPGNTPTPWWDMH |
Protein accession: | NP_690599 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.1 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SP7 is approximately 1ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |