LRRK2 monoclonal antibody (M01), clone 3B2 View larger

LRRK2 monoclonal antibody (M01), clone 3B2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LRRK2 monoclonal antibody (M01), clone 3B2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about LRRK2 monoclonal antibody (M01), clone 3B2

Brand: Abnova
Reference: H00120892-M01
Product name: LRRK2 monoclonal antibody (M01), clone 3B2
Product description: Mouse monoclonal antibody raised against a partial recombinant LRRK2.
Clone: 3B2
Isotype: IgG1 Kappa
Gene id: 120892
Gene name: LRRK2
Gene alias: AURA17|DARDARIN|PARK8|RIPK7|ROCO2
Gene description: leucine-rich repeat kinase 2
Genbank accession: AY792511
Immunogen: LRRK2 (AAV63975, 2161 a.a. ~ 2260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NSRNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVEKESWIVSGTQSGTLLVINTEDGKKRHTLEKMTDSVTCLYCNSFSKQSKQK
Protein accession: AAV63975
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00120892-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00120892-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged LRRK2 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: LRRK2 regulates autophagic activity and localizes to specific membrane microdomains in a novel human genomic reporter cellular model.Alegre-Abarrategui J, Christian H, Lufino MM, Mutihac R, Venda LL, Ansorge O, Wade-Martins R.
Hum Mol Genet. 2009 Nov 1;18(21):4022-34. Epub 2009 Jul 29.

Reviews

Buy LRRK2 monoclonal antibody (M01), clone 3B2 now

Add to cart