Brand: | Abnova |
Reference: | H00119587-M01 |
Product name: | CPXM2 monoclonal antibody (M01), clone 3E4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CPXM2. |
Clone: | 3E4 |
Isotype: | IgG2b Kappa |
Gene id: | 119587 |
Gene name: | CPXM2 |
Gene alias: | UNQ676 |
Gene description: | carboxypeptidase X (M14 family), member 2 |
Genbank accession: | NM_198148 |
Immunogen: | CPXM2 (NP_937791, 190 a.a. ~ 279 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DLQQWIEVDARRLTRFTGVITQGRNSLWLSDWVTSYKVMVSNDSHTWVTVKNGSGDMIFEGNSEKEIPVLNELPVPMVARYIRINPQSWF |
Protein accession: | NP_937791 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |