CPXM2 monoclonal antibody (M01), clone 3E4 View larger

CPXM2 monoclonal antibody (M01), clone 3E4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CPXM2 monoclonal antibody (M01), clone 3E4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about CPXM2 monoclonal antibody (M01), clone 3E4

Brand: Abnova
Reference: H00119587-M01
Product name: CPXM2 monoclonal antibody (M01), clone 3E4
Product description: Mouse monoclonal antibody raised against a partial recombinant CPXM2.
Clone: 3E4
Isotype: IgG2b Kappa
Gene id: 119587
Gene name: CPXM2
Gene alias: UNQ676
Gene description: carboxypeptidase X (M14 family), member 2
Genbank accession: NM_198148
Immunogen: CPXM2 (NP_937791, 190 a.a. ~ 279 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DLQQWIEVDARRLTRFTGVITQGRNSLWLSDWVTSYKVMVSNDSHTWVTVKNGSGDMIFEGNSEKEIPVLNELPVPMVARYIRINPQSWF
Protein accession: NP_937791
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy CPXM2 monoclonal antibody (M01), clone 3E4 now

Add to cart