Brand: | Abnova |
Reference: | H00119391-D01 |
Product name: | GSTO2 MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human GSTO2 protein. |
Gene id: | 119391 |
Gene name: | GSTO2 |
Gene alias: | bA127L20.1 |
Gene description: | glutathione S-transferase omega 2 |
Genbank accession: | NM_183239.1 |
Immunogen: | GSTO2 (NP_899062.1, 1 a.a. ~ 243 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKVPHLTKECLVALRCGRECTNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDFGLC |
Protein accession: | NP_899062.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | GSTO2 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTO2 expression in HeLa. |
Applications: | WB-Ce,WB-Tr,IP |
Shipping condition: | Dry Ice |