LYZL2 MaxPab mouse polyclonal antibody (B01) View larger

LYZL2 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LYZL2 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about LYZL2 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00119180-B01
Product name: LYZL2 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human LYZL2 protein.
Gene id: 119180
Gene name: LYZL2
Gene alias: -
Gene description: lysozyme-like 2
Genbank accession: NM_183058
Immunogen: LYZL2 (NP_898881, 1 a.a. ~ 194 a.a) full-length human protein.
Immunogen sequence/protein sequence: MQDAPLSCLSPTKWSSVSSADSTEKSASAAGTRNLPFQFCLRQALRMKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGIFQINSFAWCRRGKLKENNHCHVACSALVTDDLTDAIICAKKIVKETQGMNYWQGWKKHCEGRDLSDWKKDCEVS
Protein accession: NP_898881
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00119180-B01-13-15-1.jpg
Application image note: Western Blot analysis of LYZL2 expression in transfected 293T cell line (H00119180-T01) by LYZL2 MaxPab polyclonal antibody.

Lane 1: LYZL2 transfected lysate(21.34 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LYZL2 MaxPab mouse polyclonal antibody (B01) now

Add to cart