PDZK8 polyclonal antibody (A01) View larger

PDZK8 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PDZK8 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about PDZK8 polyclonal antibody (A01)

Brand: Abnova
Reference: H00118987-A01
Product name: PDZK8 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant PDZK8.
Gene id: 118987
Gene name: PDZD8
Gene alias: FLJ25412|FLJ34427|PDZK8|bA129M16.2
Gene description: PDZ domain containing 8
Genbank accession: NM_173791
Immunogen: PDZK8 (NP_776152, 949 a.a. ~ 1058 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: RQVSKTRLSEPGTDLVEPSPKHTPNTSDNEGSDTEVCGPNSPSKRGNSTGIKLVRKEGGLDDSVFIAVKEIGRDLYRGLPTEERIQKLEFMLDKLQNEIDQELEHNNSLV
Protein accession: NP_776152
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00118987-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PDZK8 polyclonal antibody (A01) now

Add to cart