Brand: | Abnova |
Reference: | H00118471-M06 |
Product name: | PRAP1 monoclonal antibody (M06), clone 2B4 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant PRAP1. |
Clone: | 2B4 |
Isotype: | IgG1 Kappa |
Gene id: | 118471 |
Gene name: | PRAP1 |
Gene alias: | MGC126792|PRO1195|RP11-122K13.6|UPA |
Gene description: | proline-rich acidic protein 1 |
Genbank accession: | NM_145202.3 |
Immunogen: | PRAP1 (NP_660203.2, 1 a.a. ~ 151 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MRRLLLVTSLVVVLLWEAGAVPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEEKPRGQGRGPILPGTKAWMETEDTLGRVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHPQ |
Protein accession: | NP_660203.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (43.6 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged PRAP1 is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |