PRAP1 monoclonal antibody (M06), clone 2B4 View larger

PRAP1 monoclonal antibody (M06), clone 2B4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRAP1 monoclonal antibody (M06), clone 2B4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about PRAP1 monoclonal antibody (M06), clone 2B4

Brand: Abnova
Reference: H00118471-M06
Product name: PRAP1 monoclonal antibody (M06), clone 2B4
Product description: Mouse monoclonal antibody raised against a full-length recombinant PRAP1.
Clone: 2B4
Isotype: IgG1 Kappa
Gene id: 118471
Gene name: PRAP1
Gene alias: MGC126792|PRO1195|RP11-122K13.6|UPA
Gene description: proline-rich acidic protein 1
Genbank accession: NM_145202.3
Immunogen: PRAP1 (NP_660203.2, 1 a.a. ~ 151 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MRRLLLVTSLVVVLLWEAGAVPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEEKPRGQGRGPILPGTKAWMETEDTLGRVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHPQ
Protein accession: NP_660203.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00118471-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (43.6 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00118471-M06-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged PRAP1 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PRAP1 monoclonal antibody (M06), clone 2B4 now

Add to cart