Brand: | Abnova |
Reference: | H00118427-M06 |
Product name: | OLFM3 monoclonal antibody (M06), clone 3A2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant OLFM3. |
Clone: | 3A2 |
Isotype: | IgG2a Kappa |
Gene id: | 118427 |
Gene name: | OLFM3 |
Gene alias: | NOE3|NOELIN3|NOELIN3_V1|NOELIN3_V2|NOELIN3_V3|NOELIN3_V4|NOELIN3_V5|NOELIN3_V6|OPTIMEDIN |
Gene description: | olfactomedin 3 |
Genbank accession: | NM_058170 |
Immunogen: | OLFM3 (NP_477518, 108 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FRQIEDDRKTLMTKHFQELKEKMDELLPLIPVLEQYKTDAKLITQFKEEIRNLSAVLTGIQEEIGAYDYEELHQRVLSLETRLRDCMKKLTCGKLMKIT |
Protein accession: | NP_477518 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | OLFM3 monoclonal antibody (M06), clone 3A2 Western Blot analysis of OLFM3 expression in NIH/3T3 ( Cat # L018V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |