OLFM3 monoclonal antibody (M06), clone 3A2 View larger

OLFM3 monoclonal antibody (M06), clone 3A2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of OLFM3 monoclonal antibody (M06), clone 3A2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about OLFM3 monoclonal antibody (M06), clone 3A2

Brand: Abnova
Reference: H00118427-M06
Product name: OLFM3 monoclonal antibody (M06), clone 3A2
Product description: Mouse monoclonal antibody raised against a partial recombinant OLFM3.
Clone: 3A2
Isotype: IgG2a Kappa
Gene id: 118427
Gene name: OLFM3
Gene alias: NOE3|NOELIN3|NOELIN3_V1|NOELIN3_V2|NOELIN3_V3|NOELIN3_V4|NOELIN3_V5|NOELIN3_V6|OPTIMEDIN
Gene description: olfactomedin 3
Genbank accession: NM_058170
Immunogen: OLFM3 (NP_477518, 108 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FRQIEDDRKTLMTKHFQELKEKMDELLPLIPVLEQYKTDAKLITQFKEEIRNLSAVLTGIQEEIGAYDYEELHQRVLSLETRLRDCMKKLTCGKLMKIT
Protein accession: NP_477518
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00118427-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00118427-M06-1-8-1.jpg
Application image note: OLFM3 monoclonal antibody (M06), clone 3A2 Western Blot analysis of OLFM3 expression in NIH/3T3 ( Cat # L018V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy OLFM3 monoclonal antibody (M06), clone 3A2 now

Add to cart