RFFL monoclonal antibody (M01), clone 3A4 View larger

RFFL monoclonal antibody (M01), clone 3A4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RFFL monoclonal antibody (M01), clone 3A4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about RFFL monoclonal antibody (M01), clone 3A4

Brand: Abnova
Reference: H00117584-M01
Product name: RFFL monoclonal antibody (M01), clone 3A4
Product description: Mouse monoclonal antibody raised against a partial recombinant RFFL.
Clone: 3A4
Isotype: IgG2a Kappa
Gene id: 117584
Gene name: RFFL
Gene alias: RIFIFYLIN|RNF189|RNF34L
Gene description: ring finger and FYVE-like domain containing 1
Genbank accession: NM_001017368
Immunogen: RFFL (NP_001017368, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: WATCCNWFCLDGQPEEVPPPQGARMQAYSNPGYSSFPSPTGLEPSCKSCGAHFANTARKQTCLDCKKNFCMTCSSQVGNGPRLCLLCQRFRATAFQRE
Protein accession: NP_001017368
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00117584-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00117584-M01-13-15-1.jpg
Application image note: Western Blot analysis of RFFL expression in transfected 293T cell line by RFFL monoclonal antibody (M01), clone 3A4.

Lane 1: RFFL transfected lysate(36.6 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice

Reviews

Buy RFFL monoclonal antibody (M01), clone 3A4 now

Add to cart