ALS2CR19 monoclonal antibody (M01), clone 8D7 View larger

ALS2CR19 monoclonal antibody (M01), clone 8D7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ALS2CR19 monoclonal antibody (M01), clone 8D7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about ALS2CR19 monoclonal antibody (M01), clone 8D7

Brand: Abnova
Reference: H00117583-M01
Product name: ALS2CR19 monoclonal antibody (M01), clone 8D7
Product description: Mouse monoclonal antibody raised against a partial recombinant ALS2CR19.
Clone: 8D7
Isotype: IgG1 Kappa
Gene id: 117583
Gene name: PARD3B
Gene alias: ALS2CR19|MGC16131|PAR3B|PAR3L|PAR3LC|PAR3beta|Par3Lb
Gene description: par-3 partitioning defective 3 homolog B (C. elegans)
Genbank accession: NM_152526
Immunogen: ALS2CR19 (NP_689739, 101 a.a. ~ 209 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SPDAFETEVAAQLAAFKPIGGEIEVTPSALKLGTPLLVRRSSDPVPGPPADTQPSASHPGGQSLKLVVPDSTQNLEDREVLNGVQTELLTSPRTKDTLSDMTRTVEISG
Protein accession: NP_689739
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy ALS2CR19 monoclonal antibody (M01), clone 8D7 now

Add to cart