Brand: | Abnova |
Reference: | H00117583-M01 |
Product name: | ALS2CR19 monoclonal antibody (M01), clone 8D7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ALS2CR19. |
Clone: | 8D7 |
Isotype: | IgG1 Kappa |
Gene id: | 117583 |
Gene name: | PARD3B |
Gene alias: | ALS2CR19|MGC16131|PAR3B|PAR3L|PAR3LC|PAR3beta|Par3Lb |
Gene description: | par-3 partitioning defective 3 homolog B (C. elegans) |
Genbank accession: | NM_152526 |
Immunogen: | ALS2CR19 (NP_689739, 101 a.a. ~ 209 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SPDAFETEVAAQLAAFKPIGGEIEVTPSALKLGTPLLVRRSSDPVPGPPADTQPSASHPGGQSLKLVVPDSTQNLEDREVLNGVQTELLTSPRTKDTLSDMTRTVEISG |
Protein accession: | NP_689739 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |