TWIST2 monoclonal antibody (M20A), clone 3B2 View larger

TWIST2 monoclonal antibody (M20A), clone 3B2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TWIST2 monoclonal antibody (M20A), clone 3B2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about TWIST2 monoclonal antibody (M20A), clone 3B2

Brand: Abnova
Reference: H00117581-M20A
Product name: TWIST2 monoclonal antibody (M20A), clone 3B2
Product description: Mouse monoclonal antibody raised against a partial recombinant TWIST2.
Clone: 3B2
Isotype: IgM Kappa
Gene id: 117581
Gene name: TWIST2
Gene alias: DERMO1|MGC117334|bHLHa39
Gene description: twist homolog 2 (Drosophila)
Genbank accession: NM_057179
Immunogen: TWIST2 (-, 54 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHER
Protein accession: -
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00117581-M20A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.57 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00117581-M20A-13-15-1.jpg
Application image note: Western Blot analysis of TWIST2 expression in transfected 293T cell line by TWIST2 monoclonal antibody (M20A), clone 3B2.

Lane 1: TWIST2 transfected lysate(18.1 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TWIST2 monoclonal antibody (M20A), clone 3B2 now

Add to cart