Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00117581-M20A |
Product name: | TWIST2 monoclonal antibody (M20A), clone 3B2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TWIST2. |
Clone: | 3B2 |
Isotype: | IgM Kappa |
Gene id: | 117581 |
Gene name: | TWIST2 |
Gene alias: | DERMO1|MGC117334|bHLHa39 |
Gene description: | twist homolog 2 (Drosophila) |
Genbank accession: | NM_057179 |
Immunogen: | TWIST2 (-, 54 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHER |
Protein accession: | - |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.57 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of TWIST2 expression in transfected 293T cell line by TWIST2 monoclonal antibody (M20A), clone 3B2. Lane 1: TWIST2 transfected lysate(18.1 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |