Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr,IP |
Brand: | Abnova |
Reference: | H00117581-M12 |
Product name: | TWIST2 monoclonal antibody (M12), clone 3C12 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant TWIST2. |
Clone: | 3C12 |
Isotype: | IgG1 Kappa |
Gene id: | 117581 |
Gene name: | TWIST2 |
Gene alias: | DERMO1|MGC117334|bHLHa39 |
Gene description: | twist homolog 2 (Drosophila) |
Genbank accession: | BC033168 |
Immunogen: | TWIST2 (AAH33168, 1 a.a. ~ 160 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGSWSMSASH |
Protein accession: | AAH33168 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (43.34 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of TWIST2 expression in transfected 293T cell line by TWIST2 monoclonal antibody (M12), clone 3C12. Lane 1: TWIST2 transfected lysate(18.1 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |