TWIST2 monoclonal antibody (M01), clone 3C8 View larger

TWIST2 monoclonal antibody (M01), clone 3C8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TWIST2 monoclonal antibody (M01), clone 3C8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re,WB-Tr

More info about TWIST2 monoclonal antibody (M01), clone 3C8

Brand: Abnova
Reference: H00117581-M01
Product name: TWIST2 monoclonal antibody (M01), clone 3C8
Product description: Mouse monoclonal antibody raised against a full length recombinant TWIST2.
Clone: 3C8
Isotype: IgG1 Kappa
Gene id: 117581
Gene name: TWIST2
Gene alias: DERMO1|MGC117334|bHLHa39
Gene description: twist homolog 2 (Drosophila)
Genbank accession: BC033168
Immunogen: TWIST2 (AAH33168, 1 a.a. ~ 160 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGSWSMSASH
Protein accession: AAH33168
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00117581-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (43.34 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00117581-M01-3-47-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to TWIST2 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 3 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: Epithelial-mesenchymal transition-like events in vulvar cancer and its relation with HPV.Rodrigues IS, Lavorato-Rocha AM, de M Maia B, Stiepcich MM, de Carvalho FM, Baiocchi G, Soares FA, Rocha RM
Br J Cancer. 2013 Jul 9;109(1):184-94. doi: 10.1038/bjc.2013.273. Epub 2013 Jun 18.

Reviews

Buy TWIST2 monoclonal antibody (M01), clone 3C8 now

Add to cart