Brand: | Abnova |
Reference: | H00117581-M01 |
Product name: | TWIST2 monoclonal antibody (M01), clone 3C8 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant TWIST2. |
Clone: | 3C8 |
Isotype: | IgG1 Kappa |
Gene id: | 117581 |
Gene name: | TWIST2 |
Gene alias: | DERMO1|MGC117334|bHLHa39 |
Gene description: | twist homolog 2 (Drosophila) |
Genbank accession: | BC033168 |
Immunogen: | TWIST2 (AAH33168, 1 a.a. ~ 160 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGSWSMSASH |
Protein accession: | AAH33168 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (43.34 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to TWIST2 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Epithelial-mesenchymal transition-like events in vulvar cancer and its relation with HPV.Rodrigues IS, Lavorato-Rocha AM, de M Maia B, Stiepcich MM, de Carvalho FM, Baiocchi G, Soares FA, Rocha RM Br J Cancer. 2013 Jul 9;109(1):184-94. doi: 10.1038/bjc.2013.273. Epub 2013 Jun 18. |