HRASLS5 monoclonal antibody (M02), clone 2F5 View larger

HRASLS5 monoclonal antibody (M02), clone 2F5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HRASLS5 monoclonal antibody (M02), clone 2F5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about HRASLS5 monoclonal antibody (M02), clone 2F5

Brand: Abnova
Reference: H00117245-M02
Product name: HRASLS5 monoclonal antibody (M02), clone 2F5
Product description: Mouse monoclonal antibody raised against a full-length recombinant HRASLS5.
Clone: 2F5
Isotype: IgG2b Kappa
Gene id: 117245
Gene name: HRASLS5
Gene alias: HRLP5|RLP-1|RLP1
Gene description: HRAS-like suppressor family, member 5
Genbank accession: BC034222.1
Immunogen: HRASLS5 (AAH34222.1, 1 a.a. ~ 269 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGLSPGAEGEYALRLPRIPPPLPKPASRTAGTGPKDQPPALRRSAVPHSEESVGFAALVQLPAKQPPPGTLEQGRSIQQGEKAVVSLETTPSQKADWSSIPKPENEGKLIKQAAEGKPRPRPGDLIEIFRIGYEHWAIYVEDDCVVHLAPPSEEFEVGSITSIFSNRAVVKYSRLEDVLHGCSWKVNNKLDGTYLPLPVDKIIQRTKKMVNKIVQYSLIEGNCEHFVNGLRYGVPRSQQVEHALMEGAKAAGAVISAVVDSIKPKPITA
Protein accession: AAH34222.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00117245-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (55.7 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00117245-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged HRASLS5 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HRASLS5 monoclonal antibody (M02), clone 2F5 now

Add to cart