SH2D1B monoclonal antibody (M04), clone 2B4 View larger

SH2D1B monoclonal antibody (M04), clone 2B4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SH2D1B monoclonal antibody (M04), clone 2B4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,IP

More info about SH2D1B monoclonal antibody (M04), clone 2B4

Brand: Abnova
Reference: H00117157-M04
Product name: SH2D1B monoclonal antibody (M04), clone 2B4
Product description: Mouse monoclonal antibody raised against a partial recombinant SH2D1B.
Clone: 2B4
Isotype: IgG2a Kappa
Gene id: 117157
Gene name: SH2D1B
Gene alias: EAT2
Gene description: SH2 domain containing 1B
Genbank accession: NM_053282
Immunogen: SH2D1B (NP_444512.2, 54 a.a. ~ 132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RIFREKHGYYRIQTAEGSPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETFVNSNSDYVDVLP
Protein accession: NP_444512.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00117157-M04-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged SH2D1B is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,IP
Shipping condition: Dry Ice

Reviews

Buy SH2D1B monoclonal antibody (M04), clone 2B4 now

Add to cart