Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Ce,WB-Tr |
Brand: | Abnova |
Reference: | H00117157-D01P |
Product name: | SH2D1B purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human SH2D1B protein. |
Gene id: | 117157 |
Gene name: | SH2D1B |
Gene alias: | EAT2 |
Gene description: | SH2 domain containing 1B |
Genbank accession: | NM_053282 |
Immunogen: | SH2D1B (NP_444512.2, 1 a.a. ~ 132 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MDLPYYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCVSFKNIVYTYRIFREKHGYYRIQTAEGSPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETFVNSNSDYVDVLP |
Protein accession: | NP_444512.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of SH2D1B expression in transfected 293T cell line (H00117157-T01) by SH2D1B MaxPab polyclonal antibody. Lane 1: SH2D1B transfected lysate(15.30 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ce,WB-Tr |
Shipping condition: | Dry Ice |