SH2D1B purified MaxPab rabbit polyclonal antibody (D01P) View larger

SH2D1B purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SH2D1B purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,WB-Tr

More info about SH2D1B purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00117157-D01P
Product name: SH2D1B purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human SH2D1B protein.
Gene id: 117157
Gene name: SH2D1B
Gene alias: EAT2
Gene description: SH2 domain containing 1B
Genbank accession: NM_053282
Immunogen: SH2D1B (NP_444512.2, 1 a.a. ~ 132 a.a) full-length human protein.
Immunogen sequence/protein sequence: MDLPYYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCVSFKNIVYTYRIFREKHGYYRIQTAEGSPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETFVNSNSDYVDVLP
Protein accession: NP_444512.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00117157-D01P-13-15-1.jpg
Application image note: Western Blot analysis of SH2D1B expression in transfected 293T cell line (H00117157-T01) by SH2D1B MaxPab polyclonal antibody.

Lane 1: SH2D1B transfected lysate(15.30 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SH2D1B purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart