SCGB3A2 (Human) Recombinant Protein (P01) View larger

SCGB3A2 (Human) Recombinant Protein (P01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SCGB3A2 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about SCGB3A2 (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00117156-P01
Product name: SCGB3A2 (Human) Recombinant Protein (P01)
Product description: Human SCGB3A2 full-length ORF ( AAH24232, 1 a.a. - 93 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 117156
Gene name: SCGB3A2
Gene alias: LU103|PNSP1|UGRP1
Gene description: secretoglobin, family 3A, member 2
Genbank accession: BC024232
Immunogen sequence/protein sequence: MKLVTIFLLVTISLCSYSATAFLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLLEALSHLV
Protein accession: AAH24232
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00117156-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Development of a new sensitive ELISA for the determination of uteroglobin-related protein 1, a new potential biomarker.Van De Velde V, Courtens W, Bernard A.
Biomarkers. 2010 Sep 15. [Epub ahead of print]

Reviews

Buy SCGB3A2 (Human) Recombinant Protein (P01) now

Add to cart