SCGB3A2 monoclonal antibody (M01), clone 1B2 View larger

SCGB3A2 monoclonal antibody (M01), clone 1B2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SCGB3A2 monoclonal antibody (M01), clone 1B2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SCGB3A2 monoclonal antibody (M01), clone 1B2

Brand: Abnova
Reference: H00117156-M01
Product name: SCGB3A2 monoclonal antibody (M01), clone 1B2
Product description: Mouse monoclonal antibody raised against a full length recombinant SCGB3A2.
Clone: 1B2
Isotype: IgG2a Kappa
Gene id: 117156
Gene name: SCGB3A2
Gene alias: LU103|PNSP1|UGRP1
Gene description: secretoglobin, family 3A, member 2
Genbank accession: BC024232
Immunogen: SCGB3A2 (AAH24232, 1 a.a. ~ 93 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKLVTIFLLVTISLCSYSATAFLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLLEALSHLV
Protein accession: AAH24232
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00117156-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.97 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00117156-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged SCGB3A2 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Development of a new sensitive ELISA for the determination of uteroglobin-related protein 1, a new potential biomarker.Van De Velde V, Courtens W, Bernard A.
Biomarkers. 2010 Sep 15. [Epub ahead of print]

Reviews

Buy SCGB3A2 monoclonal antibody (M01), clone 1B2 now

Add to cart