Brand: | Abnova |
Reference: | H00117156-M01 |
Product name: | SCGB3A2 monoclonal antibody (M01), clone 1B2 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant SCGB3A2. |
Clone: | 1B2 |
Isotype: | IgG2a Kappa |
Gene id: | 117156 |
Gene name: | SCGB3A2 |
Gene alias: | LU103|PNSP1|UGRP1 |
Gene description: | secretoglobin, family 3A, member 2 |
Genbank accession: | BC024232 |
Immunogen: | SCGB3A2 (AAH24232, 1 a.a. ~ 93 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MKLVTIFLLVTISLCSYSATAFLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLLEALSHLV |
Protein accession: | AAH24232 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.97 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SCGB3A2 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Development of a new sensitive ELISA for the determination of uteroglobin-related protein 1, a new potential biomarker.Van De Velde V, Courtens W, Bernard A. Biomarkers. 2010 Sep 15. [Epub ahead of print] |