MIA2 monoclonal antibody (M09), clone 2B9 View larger

MIA2 monoclonal antibody (M09), clone 2B9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MIA2 monoclonal antibody (M09), clone 2B9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about MIA2 monoclonal antibody (M09), clone 2B9

Brand: Abnova
Reference: H00117153-M09
Product name: MIA2 monoclonal antibody (M09), clone 2B9
Product description: Mouse monoclonal antibody raised against a partial recombinant MIA2.
Clone: 2B9
Isotype: IgG2a Kappa
Gene id: 117153
Gene name: MIA2
Gene alias: FLJ22404
Gene description: melanoma inhibitory activity 2
Genbank accession: NM_054024
Immunogen: MIA2 (NP_473365.3, 448 a.a. ~ 553 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TDESDTIPYLKKFLYNFDNPWNFQNIPKETELPFPKQILDQNNVIENEETGEFSIDNYPTDNTKVMIFKSSYSLSDMVSNIELPTRIHEEVYFEPSSSKDSDENSK
Protein accession: NP_473365.3
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00117153-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.4 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00117153-M09-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged MIA2 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MIA2 monoclonal antibody (M09), clone 2B9 now

Add to cart