AGAP1 monoclonal antibody (M01), clone 3F2 View larger

AGAP1 monoclonal antibody (M01), clone 3F2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AGAP1 monoclonal antibody (M01), clone 3F2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about AGAP1 monoclonal antibody (M01), clone 3F2

Brand: Abnova
Reference: H00116987-M01
Product name: AGAP1 monoclonal antibody (M01), clone 3F2
Product description: Mouse monoclonal antibody raised against a partial recombinant AGAP1.
Clone: 3F2
Isotype: IgG2b Kappa
Gene id: 116987
Gene name: AGAP1
Gene alias: CENTG2|GGAP1|KIAA1099|MGC71657
Gene description: ArfGAP with GTPase domain, ankyrin repeat and PH domain 1
Genbank accession: NM_014914
Immunogen: AGAP1 (NP_055729.2, 672 a.a. ~ 781 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LPCTELSLGQHLLRATADEDLRTAILLLAHGSRDEVNETCGEGDGRTALHLACRKGNVVLAQLLIWYGVDVTARDAHGNTALAYARQASSQECIDVLLQYGCPDERFVLM
Protein accession: NP_055729.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00116987-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00116987-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged AGAP1 is 0.3 ng/ml as a capture antibody.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy AGAP1 monoclonal antibody (M01), clone 3F2 now

Add to cart