Brand: | Abnova |
Reference: | H00116987-M01 |
Product name: | AGAP1 monoclonal antibody (M01), clone 3F2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant AGAP1. |
Clone: | 3F2 |
Isotype: | IgG2b Kappa |
Gene id: | 116987 |
Gene name: | AGAP1 |
Gene alias: | CENTG2|GGAP1|KIAA1099|MGC71657 |
Gene description: | ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 |
Genbank accession: | NM_014914 |
Immunogen: | AGAP1 (NP_055729.2, 672 a.a. ~ 781 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LPCTELSLGQHLLRATADEDLRTAILLLAHGSRDEVNETCGEGDGRTALHLACRKGNVVLAQLLIWYGVDVTARDAHGNTALAYARQASSQECIDVLLQYGCPDERFVLM |
Protein accession: | NP_055729.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged AGAP1 is 0.3 ng/ml as a capture antibody. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |