LRG1 monoclonal antibody (M03), clone 1H1 View larger

LRG1 monoclonal antibody (M03), clone 1H1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LRG1 monoclonal antibody (M03), clone 1H1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about LRG1 monoclonal antibody (M03), clone 1H1

Brand: Abnova
Reference: H00116844-M03
Product name: LRG1 monoclonal antibody (M03), clone 1H1
Product description: Mouse monoclonal antibody raised against a full-length recombinant LRG1.
Clone: 1H1
Isotype: IgG2b Kappa
Gene id: 116844
Gene name: LRG1
Gene alias: HMFT1766|LRG
Gene description: leucine-rich alpha-2-glycoprotein 1
Genbank accession: BC034389
Immunogen: LRG1 (AAH34389, 37 a.a. ~ 347 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TLSPKDCQVFRPDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPSGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQRDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ
Protein accession: AAH34389
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00116844-M03-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged LRG1 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy LRG1 monoclonal antibody (M03), clone 1H1 now

Add to cart