LRG1 monoclonal antibody (M01), clone 2E3 View larger

LRG1 monoclonal antibody (M01), clone 2E3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LRG1 monoclonal antibody (M01), clone 2E3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about LRG1 monoclonal antibody (M01), clone 2E3

Brand: Abnova
Reference: H00116844-M01
Product name: LRG1 monoclonal antibody (M01), clone 2E3
Product description: Mouse monoclonal antibody raised against a full length recombinant LRG1.
Clone: 2E3
Isotype: IgG2b Kappa
Gene id: 116844
Gene name: LRG1
Gene alias: HMFT1766|LRG
Gene description: leucine-rich alpha-2-glycoprotein 1
Genbank accession: BC034389
Immunogen: LRG1 (AAH34389, 37 a.a. ~ 347 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TLSPKDCQVFRPDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPSGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQRDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ
Protein accession: AAH34389
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00116844-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (59.95 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00116844-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged LRG1 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Leucine Rich α-2 Glycoprotein: A Novel Neutrophil Granule Protein and Modulator of Myelopoiesis.Druhan LJ, Lance A, Li S, Price AE, Emerson JT, Baxter SA, Gerber JM, Avalos BR.
PLoS One. 2017 Jan 12;12(1):e0170261. doi: 10.1371/journal.pone.0170261. eCollection 2017.

Reviews

Buy LRG1 monoclonal antibody (M01), clone 2E3 now

Add to cart