Brand: | Abnova |
Reference: | H00116832-M01 |
Product name: | RPL39L monoclonal antibody (M01), clone 4A8-1B6 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant RPL39L. |
Clone: | 4A8-1B6 |
Isotype: | IgG1 kappa |
Gene id: | 116832 |
Gene name: | RPL39L |
Gene alias: | RPL39L1 |
Gene description: | ribosomal protein L39-like |
Genbank accession: | BC012328 |
Immunogen: | RPL39L (AAH12328, 1 a.a. ~ 51 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSSHKTFTIKRFLAKKQKQNRPIPQWIQMKPGSKIRYNSKRRHWRRTKLGL |
Protein accession: | AAH12328 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (31.35 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to RPL39L on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma tissue. [antibody concentration 1 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |