RPL39L monoclonal antibody (M01), clone 4A8-1B6 View larger

RPL39L monoclonal antibody (M01), clone 4A8-1B6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RPL39L monoclonal antibody (M01), clone 4A8-1B6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about RPL39L monoclonal antibody (M01), clone 4A8-1B6

Brand: Abnova
Reference: H00116832-M01
Product name: RPL39L monoclonal antibody (M01), clone 4A8-1B6
Product description: Mouse monoclonal antibody raised against a full length recombinant RPL39L.
Clone: 4A8-1B6
Isotype: IgG1 kappa
Gene id: 116832
Gene name: RPL39L
Gene alias: RPL39L1
Gene description: ribosomal protein L39-like
Genbank accession: BC012328
Immunogen: RPL39L (AAH12328, 1 a.a. ~ 51 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSSHKTFTIKRFLAKKQKQNRPIPQWIQMKPGSKIRYNSKRRHWRRTKLGL
Protein accession: AAH12328
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00116832-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (31.35 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00116832-M01-3-15-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to RPL39L on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma tissue. [antibody concentration 1 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RPL39L monoclonal antibody (M01), clone 4A8-1B6 now

Add to cart