C1orf19 monoclonal antibody (M01), clone 8C7 View larger

C1orf19 monoclonal antibody (M01), clone 8C7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C1orf19 monoclonal antibody (M01), clone 8C7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about C1orf19 monoclonal antibody (M01), clone 8C7

Brand: Abnova
Reference: H00116461-M01
Product name: C1orf19 monoclonal antibody (M01), clone 8C7
Product description: Mouse monoclonal antibody raised against a partial recombinant C1orf19.
Clone: 8C7
Isotype: IgG1 Kappa
Gene id: 116461
Gene name: TSEN15
Gene alias: C1orf19|sen15
Gene description: tRNA splicing endonuclease 15 homolog (S. cerevisiae)
Genbank accession: NM_052965
Immunogen: C1orf19 (NP_443197, 72 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTDGFMLPDPQNISLR
Protein accession: NP_443197
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00116461-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00116461-M01-4-7-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to C1orf19 on MCF-7 cell . [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy C1orf19 monoclonal antibody (M01), clone 8C7 now

Add to cart