Brand: | Abnova |
Reference: | H00116461-D01 |
Product name: | TSEN15 MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human TSEN15 protein. |
Gene id: | 116461 |
Gene name: | TSEN15 |
Gene alias: | C1orf19|sen15 |
Gene description: | tRNA splicing endonuclease 15 homolog (S. cerevisiae) |
Genbank accession: | NM_052965.1 |
Immunogen: | TSEN15 (NP_443197.1, 1 a.a. ~ 171 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MEERGDSEPTPGCSGLGPGGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATQVYVAFLVYLDLMESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTDGFMLPDPQNISLRR |
Protein accession: | NP_443197.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | C1orf19 MaxPab rabbit polyclonal antibody. Western Blot analysis of C1orf19 expression in human kidney. |
Applications: | WB-Ti,WB-Tr,IP |
Shipping condition: | Dry Ice |