TSEN15 MaxPab rabbit polyclonal antibody (D01) View larger

TSEN15 MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TSEN15 MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr,IP

More info about TSEN15 MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00116461-D01
Product name: TSEN15 MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human TSEN15 protein.
Gene id: 116461
Gene name: TSEN15
Gene alias: C1orf19|sen15
Gene description: tRNA splicing endonuclease 15 homolog (S. cerevisiae)
Genbank accession: NM_052965.1
Immunogen: TSEN15 (NP_443197.1, 1 a.a. ~ 171 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEERGDSEPTPGCSGLGPGGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATQVYVAFLVYLDLMESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTDGFMLPDPQNISLRR
Protein accession: NP_443197.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00116461-D01-2-A0-1.jpg
Application image note: C1orf19 MaxPab rabbit polyclonal antibody. Western Blot analysis of C1orf19 expression in human kidney.
Applications: WB-Ti,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy TSEN15 MaxPab rabbit polyclonal antibody (D01) now

Add to cart