OLIG1 monoclonal antibody (M08), clone 2A4 View larger

OLIG1 monoclonal antibody (M08), clone 2A4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of OLIG1 monoclonal antibody (M08), clone 2A4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,IP

More info about OLIG1 monoclonal antibody (M08), clone 2A4

Brand: Abnova
Reference: H00116448-M08
Product name: OLIG1 monoclonal antibody (M08), clone 2A4
Product description: Mouse monoclonal antibody raised against a full length recombinant OLIG1.
Clone: 2A4
Isotype: IgG2a Kappa
Gene id: 116448
Gene name: OLIG1
Gene alias: BHLHB6|bHLHe21
Gene description: oligodendrocyte transcription factor 1
Genbank accession: NM_138983.1
Immunogen: OLIG1 (NP_620450.1, 80 a.a. ~ 159 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PDAKEEQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRAL
Protein accession: NP_620450.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00116448-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.8 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00116448-M08-31-15-1.jpg
Application image note: Immunoprecipitation of OLIG1 transfected lysate using anti-OLIG1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with OLIG1 MaxPab rabbit polyclonal antibody.
Applications: ELISA,WB-Re,IP
Shipping condition: Dry Ice

Reviews

Buy OLIG1 monoclonal antibody (M08), clone 2A4 now

Add to cart