OLIG1 monoclonal antibody (M06), clone 3E3 View larger

OLIG1 monoclonal antibody (M06), clone 3E3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of OLIG1 monoclonal antibody (M06), clone 3E3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,IP

More info about OLIG1 monoclonal antibody (M06), clone 3E3

Brand: Abnova
Reference: H00116448-M06
Product name: OLIG1 monoclonal antibody (M06), clone 3E3
Product description: Mouse monoclonal antibody raised against a full length recombinant OLIG1.
Clone: 3E3
Isotype: IgG2a Kappa
Gene id: 116448
Gene name: OLIG1
Gene alias: BHLHB6|bHLHe21
Gene description: oligodendrocyte transcription factor 1
Genbank accession: NM_138983.1
Immunogen: OLIG1 (NP_620450.1, 80 a.a. ~ 159 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PDAKEEQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRAL
Protein accession: NP_620450.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00116448-M06-31-15-1.jpg
Application image note: Immunoprecipitation of OLIG1 transfected lysate using anti-OLIG1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with OLIG1 MaxPab rabbit polyclonal antibody.
Applications: ELISA,IP
Shipping condition: Dry Ice

Reviews

Buy OLIG1 monoclonal antibody (M06), clone 3E3 now

Add to cart