Brand: | Abnova |
Reference: | H00116448-M04 |
Product name: | OLIG1 monoclonal antibody (M04), clone 2B11 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant OLIG1. |
Clone: | 2B11 |
Isotype: | IgG2a Kappa |
Gene id: | 116448 |
Gene name: | OLIG1 |
Gene alias: | BHLHB6|bHLHe21 |
Gene description: | oligodendrocyte transcription factor 1 |
Genbank accession: | NM_138983.1 |
Immunogen: | OLIG1 (NP_620450.1, 80 a.a. ~ 159 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PDAKEEQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRAL |
Protein accession: | NP_620450.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.8 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoprecipitation of OLIG1 transfected lysate using anti-OLIG1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with OLIG1 MaxPab rabbit polyclonal antibody. |
Applications: | IF,ELISA,WB-Re,IP |
Shipping condition: | Dry Ice |