OLIG1 MaxPab mouse polyclonal antibody (B01) View larger

OLIG1 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of OLIG1 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about OLIG1 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00116448-B01
Product name: OLIG1 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human OLIG1 protein.
Gene id: 116448
Gene name: OLIG1
Gene alias: BHLHB6|bHLHe21
Gene description: oligodendrocyte transcription factor 1
Genbank accession: NM_138983.1
Immunogen: OLIG1 (NP_620450.1, 1 a.a. ~ 255 a.a) full-length human protein.
Immunogen sequence/protein sequence: MLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSSTTAPLLPKAAREKPEAPAEPPGPGPGSGAHPGGSARPDAKEEQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRALGEGAGPAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPDALRPAKYLSLALDEPPCGQFALPGGGAGGPGLCTCAVCKFPHLVPASLGLAAVQAQFSK
Protein accession: NP_620450.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00116448-B01-13-15-1.jpg
Application image note: Western Blot analysis of OLIG1 expression in transfected 293T cell line (H00116448-T01) by OLIG1 MaxPab polyclonal antibody.

Lane 1: OLIG1 transfected lysate(28.05 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy OLIG1 MaxPab mouse polyclonal antibody (B01) now

Add to cart