RAB39B monoclonal antibody (M02), clone 3B7 View larger

RAB39B monoclonal antibody (M02), clone 3B7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAB39B monoclonal antibody (M02), clone 3B7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about RAB39B monoclonal antibody (M02), clone 3B7

Brand: Abnova
Reference: H00116442-M02
Product name: RAB39B monoclonal antibody (M02), clone 3B7
Product description: Mouse monoclonal antibody raised against a full-length recombinant RAB39B.
Clone: 3B7
Isotype: IgG1 Kappa
Gene id: 116442
Gene name: RAB39B
Gene alias: -
Gene description: RAB39B, member RAS oncogene family
Genbank accession: BC009714
Immunogen: RAB39B (AAH09714, 1 a.a. ~ 213 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSGFVPNVVHSSEEVVKSERRCLC
Protein accession: AAH09714
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00116442-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (49.17 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00116442-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged RAB39B is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RAB39B monoclonal antibody (M02), clone 3B7 now

Add to cart