RAB39B monoclonal antibody (M01), clone 1E11 View larger

RAB39B monoclonal antibody (M01), clone 1E11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAB39B monoclonal antibody (M01), clone 1E11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about RAB39B monoclonal antibody (M01), clone 1E11

Brand: Abnova
Reference: H00116442-M01
Product name: RAB39B monoclonal antibody (M01), clone 1E11
Product description: Mouse monoclonal antibody raised against a full length recombinant RAB39B.
Clone: 1E11
Isotype: IgG1 kappa
Gene id: 116442
Gene name: RAB39B
Gene alias: -
Gene description: RAB39B, member RAS oncogene family
Genbank accession: BC009714
Immunogen: RAB39B (AAH09714, 1 a.a. ~ 213 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSGFVPNVVHSSEEVVKSERRCLC
Protein accession: AAH09714
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00116442-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (49.17 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00116442-M01-13-15-1.jpg
Application image note: Western Blot analysis of RAB39B expression in transfected 293T cell line by RAB39B monoclonal antibody (M01), clone 1E11.

Lane 1: RAB39B transfected lysate(25 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RAB39B monoclonal antibody (M01), clone 1E11 now

Add to cart