MOGAT1 MaxPab mouse polyclonal antibody (B01) View larger

MOGAT1 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MOGAT1 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about MOGAT1 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00116255-B01
Product name: MOGAT1 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human MOGAT1 protein.
Gene id: 116255
Gene name: MOGAT1
Gene alias: DGAT2L|DGAT2L1|MGAT1
Gene description: monoacylglycerol O-acyltransferase 1
Genbank accession: BC146518
Immunogen: MOGAT1 (AAI46519.1, 1 a.a. ~ 334 a.a) full-length human protein.
Immunogen sequence/protein sequence: MKVEFAPLNIQLARRLQTVAVLQWVLSFLTGPMSIGITVMLIIHNYLFLYIPYLMWLYFDWHTPERGGRRSSWIKNWTLWKHFKDYFPIHLIKTQDLDPSHNYIFGFHPHGIMAVGAFGNFSVNYSDFKDLFPGFTSYLHVLPLWFWCPVFREYVMSVGLVSVSKKSVSYMVSKEGGGNISVIVLGGAKESLDAHPGKFTLFIRQRKGFVKIALTHGASLVPVVSFGENELFKQTDNPEGSWIRTVQNKLQKIMGFALPLFHARGVFQYNFGLMTYRKAIHTVVGRPIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK
Protein accession: AAI46519.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00116255-B01-13-15-1.jpg
Application image note: Western Blot analysis of MOGAT1 expression in transfected 293T cell line (H00116255-T01) by MOGAT1 MaxPab polyclonal antibody.

Lane 1: MOGAT1 transfected lysate(36.74 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MOGAT1 MaxPab mouse polyclonal antibody (B01) now

Add to cart