Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00116224-M03 |
Product name: | FAM122A monoclonal antibody (M03), clone 3E9 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant FAM122A. |
Clone: | 3E9 |
Isotype: | IgG2a Kappa |
Gene id: | 116224 |
Gene name: | FAM122A |
Gene alias: | C9orf42|MGC17347 |
Gene description: | family with sequence similarity 122A |
Genbank accession: | NM_138333.3 |
Immunogen: | FAM122A (NP_612206.3, 1 a.a. ~ 287 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAQEKMELDLELPPGTGGSPAEGGGSGGGGGLRRSNSAPLIHGLSDTSPVFQAEAPSARRNSTTFPSRHGLLLPASPVRMHSSRLHQIKQEEGMDLINRETVHEREVQTAMQISHSWEESFSLSDNDVEKSASPKRIDFIPVSPAPSPTRGIGKQCFSPSLQSFVSSNGLPPSPIPSPTTRFTTRRSQSPINCIRPSVLGPLKRKCEMETEYQPKRFFQGITNMLSSDVAQLSDPGVCVSSDTLDGNSSSAGSSCNSPAKVSTTTDSPVSPAQAASPFIPLDELSSK |
Protein accession: | NP_612206.3 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (56.9 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of FAM122A expression in transfected 293T cell line by FAM122A monoclonal antibody (M03), clone 3E9. Lane 1: FAM122A transfected lysate (Predicted MW: 30.5 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |