FAM122A monoclonal antibody (M03), clone 3E9 View larger

FAM122A monoclonal antibody (M03), clone 3E9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FAM122A monoclonal antibody (M03), clone 3E9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about FAM122A monoclonal antibody (M03), clone 3E9

Brand: Abnova
Reference: H00116224-M03
Product name: FAM122A monoclonal antibody (M03), clone 3E9
Product description: Mouse monoclonal antibody raised against a full-length recombinant FAM122A.
Clone: 3E9
Isotype: IgG2a Kappa
Gene id: 116224
Gene name: FAM122A
Gene alias: C9orf42|MGC17347
Gene description: family with sequence similarity 122A
Genbank accession: NM_138333.3
Immunogen: FAM122A (NP_612206.3, 1 a.a. ~ 287 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAQEKMELDLELPPGTGGSPAEGGGSGGGGGLRRSNSAPLIHGLSDTSPVFQAEAPSARRNSTTFPSRHGLLLPASPVRMHSSRLHQIKQEEGMDLINRETVHEREVQTAMQISHSWEESFSLSDNDVEKSASPKRIDFIPVSPAPSPTRGIGKQCFSPSLQSFVSSNGLPPSPIPSPTTRFTTRRSQSPINCIRPSVLGPLKRKCEMETEYQPKRFFQGITNMLSSDVAQLSDPGVCVSSDTLDGNSSSAGSSCNSPAKVSTTTDSPVSPAQAASPFIPLDELSSK
Protein accession: NP_612206.3
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00116224-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (56.9 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00116224-M03-13-15-1.jpg
Application image note: Western Blot analysis of FAM122A expression in transfected 293T cell line by FAM122A monoclonal antibody (M03), clone 3E9.

Lane 1: FAM122A transfected lysate (Predicted MW: 30.5 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FAM122A monoclonal antibody (M03), clone 3E9 now

Add to cart