Brand: | Abnova |
Reference: | H00116173-M02 |
Product name: | CMTM5 monoclonal antibody (M02), clone 2B10 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant CMTM5. |
Clone: | 2B10 |
Isotype: | IgG3 Lambda |
Gene id: | 116173 |
Gene name: | CMTM5 |
Gene alias: | CKLFSF5|FLJ37521 |
Gene description: | CKLF-like MARVEL transmembrane domain containing 5 |
Genbank accession: | BC013109 |
Immunogen: | CMTM5 (AAH13109, 1 a.a. ~ 156 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGILLETELALTLIIFICFTASISAYMAAALLEFFITLAFLFLYATQYYQRFDRINWPCLDFLRCVSAIIIFLVVSFAAVTSRDGAAIAAFVFGIILVSIFAYDAFKIYRTEMAPGASQGDQQ |
Protein accession: | AAH13109 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |