CMTM5 monoclonal antibody (M02), clone 2B10 View larger

CMTM5 monoclonal antibody (M02), clone 2B10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CMTM5 monoclonal antibody (M02), clone 2B10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about CMTM5 monoclonal antibody (M02), clone 2B10

Brand: Abnova
Reference: H00116173-M02
Product name: CMTM5 monoclonal antibody (M02), clone 2B10
Product description: Mouse monoclonal antibody raised against a full length recombinant CMTM5.
Clone: 2B10
Isotype: IgG3 Lambda
Gene id: 116173
Gene name: CMTM5
Gene alias: CKLFSF5|FLJ37521
Gene description: CKLF-like MARVEL transmembrane domain containing 5
Genbank accession: BC013109
Immunogen: CMTM5 (AAH13109, 1 a.a. ~ 156 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGILLETELALTLIIFICFTASISAYMAAALLEFFITLAFLFLYATQYYQRFDRINWPCLDFLRCVSAIIIFLVVSFAAVTSRDGAAIAAFVFGIILVSIFAYDAFKIYRTEMAPGASQGDQQ
Protein accession: AAH13109
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy CMTM5 monoclonal antibody (M02), clone 2B10 now

Add to cart