CKLFSF5 monoclonal antibody (M01), clone 2G1-6B10 View larger

CKLFSF5 monoclonal antibody (M01), clone 2G1-6B10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CKLFSF5 monoclonal antibody (M01), clone 2G1-6B10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about CKLFSF5 monoclonal antibody (M01), clone 2G1-6B10

Brand: Abnova
Reference: H00116173-M01
Product name: CKLFSF5 monoclonal antibody (M01), clone 2G1-6B10
Product description: Mouse monoclonal antibody raised against a full length recombinant CKLFSF5.
Clone: 2G1-6B10
Isotype: IgG1 kappa
Gene id: 116173
Gene name: CMTM5
Gene alias: CKLFSF5|FLJ37521
Gene description: CKLF-like MARVEL transmembrane domain containing 5
Genbank accession: BC013109
Immunogen: CKLFSF5 (AAH13109, 1 a.a. ~ 156 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGILLETELALTLIIFICFTASISAYMAAALLEFFITLAFLFLYATQYYQRFDRINWPCLDFLRCVSAIIIFLVVSFAAVTSRDGAAIAAFVFGIILVSIFAYDAFKIYRTEMAPGASQGDQQ
Protein accession: AAH13109
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00116173-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (42.9 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00116173-M01-13-15-1.jpg
Application image note: Western Blot analysis of CMTM5 expression in transfected 293T cell line by CKLFSF5 monoclonal antibody (M01), clone 2G1-6B10.

Lane 1: CMTM5 transfected lysate(17 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CKLFSF5 monoclonal antibody (M01), clone 2G1-6B10 now

Add to cart