Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00116173-M01 |
Product name: | CKLFSF5 monoclonal antibody (M01), clone 2G1-6B10 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant CKLFSF5. |
Clone: | 2G1-6B10 |
Isotype: | IgG1 kappa |
Gene id: | 116173 |
Gene name: | CMTM5 |
Gene alias: | CKLFSF5|FLJ37521 |
Gene description: | CKLF-like MARVEL transmembrane domain containing 5 |
Genbank accession: | BC013109 |
Immunogen: | CKLFSF5 (AAH13109, 1 a.a. ~ 156 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGILLETELALTLIIFICFTASISAYMAAALLEFFITLAFLFLYATQYYQRFDRINWPCLDFLRCVSAIIIFLVVSFAAVTSRDGAAIAAFVFGIILVSIFAYDAFKIYRTEMAPGASQGDQQ |
Protein accession: | AAH13109 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (42.9 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CMTM5 expression in transfected 293T cell line by CKLFSF5 monoclonal antibody (M01), clone 2G1-6B10. Lane 1: CMTM5 transfected lysate(17 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |