PHACTR3 monoclonal antibody (M02), clone 4A5 View larger

PHACTR3 monoclonal antibody (M02), clone 4A5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PHACTR3 monoclonal antibody (M02), clone 4A5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about PHACTR3 monoclonal antibody (M02), clone 4A5

Brand: Abnova
Reference: H00116154-M02
Product name: PHACTR3 monoclonal antibody (M02), clone 4A5
Product description: Mouse monoclonal antibody raised against a partial recombinant PHACTR3.
Clone: 4A5
Isotype: IgG2a Kappa
Gene id: 116154
Gene name: PHACTR3
Gene alias: C20orf101|H17739|MGC117178|SCAPIN1|SCAPININ
Gene description: phosphatase and actin regulator 3
Genbank accession: NM_080672
Immunogen: PHACTR3 (NP_542403.1, 92 a.a. ~ 179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TSALEKKMAGRQGREELIKKGLLEMMEQDAESKTCNPDGGPRSVQSEPPTPKSETLTSEDAQPGSPLATGTDQVSLDKPLSSAAHLDD
Protein accession: NP_542403.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00116154-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.42 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00116154-M02-13-15-1.jpg
Application image note: Western Blot analysis of PHACTR3 expression in transfected 293T cell line by PHACTR3 monoclonal antibody (M02), clone 4A5.

Lane 1: PHACTR3 transfected lysate(51.5 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PHACTR3 monoclonal antibody (M02), clone 4A5 now

Add to cart