FMO9P purified MaxPab mouse polyclonal antibody (B01P) View larger

FMO9P purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FMO9P purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about FMO9P purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00116123-B01P
Product name: FMO9P purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human FMO9P protein.
Gene id: 116123
Gene name: FMO9P
Gene alias: MGC23941
Gene description: flavin containing monooxygenase 9 pseudogene
Genbank accession: BC014341.1
Immunogen: FMO9P (AAH14341.1, 1 a.a. ~ 160 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPSIYKSVTINTSKEMMCFSDFPVPDHFPNYMHNSKLMDYFGMYATHFGLLNYIRFKTEVQSVRKHPDFSINGQWDVVVETEEKQETLVFDGVLVCSGHHTDPYLPLQSFPGIEKFEGCYFHSREYKSPEDFSGKRIIVIGIGNSGVDIAVELSRVAKQI
Protein accession: AAH14341.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00116123-B01P-13-15-1.jpg
Application image note: Western Blot analysis of FMO9P expression in transfected 293T cell line (H00116123-T01) by FMO9P MaxPab polyclonal antibody.

Lane 1: LOC116123 transfected lysate(17.6 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FMO9P purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart