Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FOXP4 monoclonal antibody (M01), clone 3B12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about FOXP4 monoclonal antibody (M01), clone 3B12
| Brand: | Abnova |
| Reference: | H00116113-M01 |
| Product name: | FOXP4 monoclonal antibody (M01), clone 3B12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FOXP4. |
| Clone: | 3B12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 116113 |
| Gene name: | FOXP4 |
| Gene alias: | FLJ40908|FLJ44184|hFKHLA |
| Gene description: | forkhead box P4 |
| Genbank accession: | NM_001012426 |
| Immunogen: | FOXP4 (NP_001012426.1, 586 a.a. ~ 679 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LNSPGMLNPGSASSLLPLSHDDVGAPVEPLPSNGSSSPPRLSPPQYSHQVQVKEEPAEAEEDRQPGPPLGAPNPSASGPPEDRDLEEELPGEEL |
| Protein accession: | NP_001012426.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.08 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of FOXP4 expression in transfected 293T cell line by FOXP4 monoclonal antibody (M01), clone 3B12. Lane 1: FOXP4 transfected lysate(73.2 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Convergent repression of Foxp2 3'UTR by miR-9 and miR-132 in embryonic mouse neocortex: implications for radial migration of neurons.Clovis YM, Enard W, Marinaro F, Huttner WB, De Pietri Tonelli D. Development. 2012 Sep;139(18):3332-42. Epub 2012 Aug 8. |