FOXP4 monoclonal antibody (M01), clone 3B12 View larger

FOXP4 monoclonal antibody (M01), clone 3B12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FOXP4 monoclonal antibody (M01), clone 3B12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about FOXP4 monoclonal antibody (M01), clone 3B12

Brand: Abnova
Reference: H00116113-M01
Product name: FOXP4 monoclonal antibody (M01), clone 3B12
Product description: Mouse monoclonal antibody raised against a partial recombinant FOXP4.
Clone: 3B12
Isotype: IgG2a Kappa
Gene id: 116113
Gene name: FOXP4
Gene alias: FLJ40908|FLJ44184|hFKHLA
Gene description: forkhead box P4
Genbank accession: NM_001012426
Immunogen: FOXP4 (NP_001012426.1, 586 a.a. ~ 679 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LNSPGMLNPGSASSLLPLSHDDVGAPVEPLPSNGSSSPPRLSPPQYSHQVQVKEEPAEAEEDRQPGPPLGAPNPSASGPPEDRDLEEELPGEEL
Protein accession: NP_001012426.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00116113-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.08 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00116113-M01-13-15-1.jpg
Application image note: Western Blot analysis of FOXP4 expression in transfected 293T cell line by FOXP4 monoclonal antibody (M01), clone 3B12.

Lane 1: FOXP4 transfected lysate(73.2 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: Convergent repression of Foxp2 3'UTR by miR-9 and miR-132 in embryonic mouse neocortex: implications for radial migration of neurons.Clovis YM, Enard W, Marinaro F, Huttner WB, De Pietri Tonelli D.
Development. 2012 Sep;139(18):3332-42. Epub 2012 Aug 8.

Reviews

Buy FOXP4 monoclonal antibody (M01), clone 3B12 now

Add to cart