Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00116113-M01 |
Product name: | FOXP4 monoclonal antibody (M01), clone 3B12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FOXP4. |
Clone: | 3B12 |
Isotype: | IgG2a Kappa |
Gene id: | 116113 |
Gene name: | FOXP4 |
Gene alias: | FLJ40908|FLJ44184|hFKHLA |
Gene description: | forkhead box P4 |
Genbank accession: | NM_001012426 |
Immunogen: | FOXP4 (NP_001012426.1, 586 a.a. ~ 679 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LNSPGMLNPGSASSLLPLSHDDVGAPVEPLPSNGSSSPPRLSPPQYSHQVQVKEEPAEAEEDRQPGPPLGAPNPSASGPPEDRDLEEELPGEEL |
Protein accession: | NP_001012426.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.08 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of FOXP4 expression in transfected 293T cell line by FOXP4 monoclonal antibody (M01), clone 3B12. Lane 1: FOXP4 transfected lysate(73.2 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Convergent repression of Foxp2 3'UTR by miR-9 and miR-132 in embryonic mouse neocortex: implications for radial migration of neurons.Clovis YM, Enard W, Marinaro F, Huttner WB, De Pietri Tonelli D. Development. 2012 Sep;139(18):3332-42. Epub 2012 Aug 8. |