SLC22A12 monoclonal antibody (M02), clone 2B5 View larger

SLC22A12 monoclonal antibody (M02), clone 2B5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC22A12 monoclonal antibody (M02), clone 2B5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,S-ELISA,ELISA,WB-Re

More info about SLC22A12 monoclonal antibody (M02), clone 2B5

Brand: Abnova
Reference: H00116085-M02
Product name: SLC22A12 monoclonal antibody (M02), clone 2B5
Product description: Mouse monoclonal antibody raised against a partial recombinant SLC22A12.
Clone: 2B5
Isotype: IgG2a Kappa
Gene id: 116085
Gene name: SLC22A12
Gene alias: OAT4L|RST|URAT1
Gene description: solute carrier family 22 (organic anion/urate transporter), member 12
Genbank accession: NM_144585
Immunogen: SLC22A12 (NP_653186.2, 281 a.a. ~ 349 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ESARWLLTTGRLDWGLQELWRVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFR
Protein accession: NP_653186.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00116085-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.33 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00116085-M02-2-A3-1.jpg
Application image note: SLC22A12 monoclonal antibody (M02), clone 2B5. Western Blot analysis of SLC22A12 expression in human stomach.
Applications: WB-Ti,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: OIT3 deficiency impairs uric acid reabsorption in renal tubule.Yan B, Zhang ZZ, Huang LY, Shen HL, Han ZG.
FEBS Lett. 2012 Jan 28. [Epub ahead of print]

Reviews

Buy SLC22A12 monoclonal antibody (M02), clone 2B5 now

Add to cart