Brand: | Abnova |
Reference: | H00116085-M02 |
Product name: | SLC22A12 monoclonal antibody (M02), clone 2B5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC22A12. |
Clone: | 2B5 |
Isotype: | IgG2a Kappa |
Gene id: | 116085 |
Gene name: | SLC22A12 |
Gene alias: | OAT4L|RST|URAT1 |
Gene description: | solute carrier family 22 (organic anion/urate transporter), member 12 |
Genbank accession: | NM_144585 |
Immunogen: | SLC22A12 (NP_653186.2, 281 a.a. ~ 349 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ESARWLLTTGRLDWGLQELWRVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFR |
Protein accession: | NP_653186.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.33 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SLC22A12 monoclonal antibody (M02), clone 2B5. Western Blot analysis of SLC22A12 expression in human stomach. |
Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | OIT3 deficiency impairs uric acid reabsorption in renal tubule.Yan B, Zhang ZZ, Huang LY, Shen HL, Han ZG. FEBS Lett. 2012 Jan 28. [Epub ahead of print] |