BATF2 monoclonal antibody (M01), clone 1B11 View larger

BATF2 monoclonal antibody (M01), clone 1B11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BATF2 monoclonal antibody (M01), clone 1B11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about BATF2 monoclonal antibody (M01), clone 1B11

Brand: Abnova
Reference: H00116071-M01
Product name: BATF2 monoclonal antibody (M01), clone 1B11
Product description: Mouse monoclonal antibody raised against a full-length recombinant BATF2.
Clone: 1B11
Isotype: IgG2b Kappa
Gene id: 116071
Gene name: BATF2
Gene alias: MGC20410
Gene description: basic leucine zipper transcription factor, ATF-like 2
Genbank accession: BC012330
Immunogen: BATF2 (AAH12330, 1 a.a. ~ 189 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDCASCSAPGLLGCWDQAEGLLGPGPQGQHGCREQLELFQTPGSCYPAQPLSPGPQPHDSPSLLQCPLPSLSLGPAVVAEPPVQLSPSPLLFASHTGSSLQGSSSKLSALQPSLTAQTAPPQPLELEHPTRGKLGSSPDNPSSALGLARLQSREHKPALSAATWQGLVVDPSPHPLLAFPLLSSAQVHF
Protein accession: AAH12330
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00116071-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (46.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00116071-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged BATF2 is 0.3 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy BATF2 monoclonal antibody (M01), clone 1B11 now

Add to cart