CTHRC1 monoclonal antibody (M05), clone 1G12 View larger

CTHRC1 monoclonal antibody (M05), clone 1G12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CTHRC1 monoclonal antibody (M05), clone 1G12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re,WB-Tr

More info about CTHRC1 monoclonal antibody (M05), clone 1G12

Brand: Abnova
Reference: H00115908-M05
Product name: CTHRC1 monoclonal antibody (M05), clone 1G12
Product description: Mouse monoclonal antibody raised against a partial recombinant CTHRC1.
Clone: 1G12
Isotype: IgG2a Kappa
Gene id: 115908
Gene name: CTHRC1
Gene alias: -
Gene description: collagen triple helix repeat containing 1
Genbank accession: NM_138455
Immunogen: CTHRC1 (NP_612464, 32 a.a. ~ 141 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLF
Protein accession: NP_612464
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00115908-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.62 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00115908-M05-13-15-1.jpg
Application image note: Western Blot analysis of CTHRC1 expression in transfected 293T cell line by CTHRC1 monoclonal antibody (M05), clone 1G12.

Lane 1: CTHRC1 transfected lysate(26.2 KDa).
Lane 2: Non-transfected lysate.
Applications: IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: Collagen Triple Helix Repeat Containing-1 (CTHRC1) Expression in Invasive Ductal Carcinoma of the Breast: The Impact on Prognosis and Correlation to Clinicopathologic Features.Kim JH, Baek TH, Yim HS, Kim KH, Jeong SH, Kang HB, Oh SS, Lee HG, Kim JW, Kim KD
Pathol Oncol Res. 2013 May 9.

Reviews

Buy CTHRC1 monoclonal antibody (M05), clone 1G12 now

Add to cart