NXNL1 monoclonal antibody (M01), clone 7H3 View larger

NXNL1 monoclonal antibody (M01), clone 7H3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NXNL1 monoclonal antibody (M01), clone 7H3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about NXNL1 monoclonal antibody (M01), clone 7H3

Brand: Abnova
Reference: H00115861-M01
Product name: NXNL1 monoclonal antibody (M01), clone 7H3
Product description: Mouse monoclonal antibody raised against a partial recombinant NXNL1.
Clone: 7H3
Isotype: IgG2b Kappa
Gene id: 115861
Gene name: NXNL1
Gene alias: RDCVF|TXNL6
Gene description: nucleoredoxin-like 1
Genbank accession: NM_138454
Immunogen: NXNL1 (NP_612463, 81 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DSTEEQQDLFLKDMPKKWLFLPFEDDLRRDLGRQFSVERLPAVVVLKPDGDVLTRDGADEIQRLGTACFANWQEAAEVLDRNFQLPEDLEDQEPRSLTECLRRHKYRVEK
Protein accession: NP_612463
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00115861-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00115861-M01-13-15-1.jpg
Application image note: Western Blot analysis of NXNL1 expression in transfected 293T cell line by TXNL6 monoclonal antibody (M01), clone 7H3.

Lane 1: NXNL1 transfected lysate(23.9 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NXNL1 monoclonal antibody (M01), clone 7H3 now

Add to cart