RAB3C monoclonal antibody (M07), clone 1H4 View larger

RAB3C monoclonal antibody (M07), clone 1H4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAB3C monoclonal antibody (M07), clone 1H4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about RAB3C monoclonal antibody (M07), clone 1H4

Brand: Abnova
Reference: H00115827-M07
Product name: RAB3C monoclonal antibody (M07), clone 1H4
Product description: Mouse monoclonal antibody raised against a full-length recombinant RAB3C.
Clone: 1H4
Isotype: IgG2b Kappa
Gene id: 115827
Gene name: RAB3C
Gene alias: -
Gene description: RAB3C, member RAS oncogene family
Genbank accession: BC013033
Immunogen: RAB3C (AAH13033, 1 a.a. ~ 227 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MRHEAPMQMASAQDARYGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVIQVGNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAITAAKQNTRLKETPPPPQPNCAC
Protein accession: AAH13033
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00115827-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (50.71 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00115827-M07-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged RAB3C is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RAB3C monoclonal antibody (M07), clone 1H4 now

Add to cart