ALPK2 monoclonal antibody (M05), clone 4E5 View larger

ALPK2 monoclonal antibody (M05), clone 4E5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ALPK2 monoclonal antibody (M05), clone 4E5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ALPK2 monoclonal antibody (M05), clone 4E5

Brand: Abnova
Reference: H00115701-M05
Product name: ALPK2 monoclonal antibody (M05), clone 4E5
Product description: Mouse monoclonal antibody raised against a partial recombinant ALPK2.
Clone: 4E5
Isotype: IgG2a Kappa
Gene id: 115701
Gene name: ALPK2
Gene alias: FLJ34875|FLJ43253|HAK
Gene description: alpha-kinase 2
Genbank accession: NM_052947
Immunogen: ALPK2 (NP_443179, 201 a.a. ~ 309 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DGTSSVTEQGRYKLPTAPEAAENDYPGIQGETRDSHQAREEFASDNLLNMDESVRETEMKLLSGESENSGMSQCWETAADKRVGGKDLWSKRGSRKSARVRQPGMKGNP
Protein accession: NP_443179
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00115701-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice
Publications: An Alpha-kinase 2 Gene Variant Disrupts Filamentous Actin Localization in the Surface Cells of Colorectal Cancer Spheroids.Nishi K, Luo H, Nakabayashi K, Doi K, Ishikura S, Iwaihara Y, Yoshida Y, Tanisawa K, Arai T, Mori S, Sawabe M, Muramatsu M, Tanaka M, Sakata T, Shirasawa S, Tsunoda T.
Anticancer Res. 2017 Jul;37(7):3855-3862.

Reviews

Buy ALPK2 monoclonal antibody (M05), clone 4E5 now

Add to cart