H00115650-B01P_50ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00115650-B01P |
Product name: | TNFRSF13C purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human TNFRSF13C protein. |
Gene id: | 115650 |
Gene name: | TNFRSF13C |
Gene alias: | BAFF-R|BAFFR|CD268|MGC138235 |
Gene description: | tumor necrosis factor receptor superfamily, member 13C |
Genbank accession: | NM_052945.2 |
Immunogen: | TNFRSF13C (NP_443177.1, 1 a.a. ~ 184 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ |
Protein accession: | NP_443177.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of TNFRSF13C expression in transfected 293T cell line (H00115650-T01) by TNFRSF13C MaxPab polyclonal antibody. Lane1:TNFRSF13C transfected lysate(20.24 KDa). Lane2:Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |