ZNF501 MaxPab mouse polyclonal antibody (B01) View larger

ZNF501 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF501 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about ZNF501 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00115560-B01
Product name: ZNF501 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human ZNF501 protein.
Gene id: 115560
Gene name: ZNF501
Gene alias: MGC21738|ZNF|ZNF52
Gene description: zinc finger protein 501
Genbank accession: ENST00000302420
Immunogen: ZNF501 (ENSP00000307556, 1 a.a. ~ 262 a.a) full-length human protein.
Immunogen sequence/protein sequence: MKHGRVNMQKKPSKCSECGKFFTQRSSLTQHQRIHRGEKPYVCSECGSCFRKQSNLTQHLRIHTGEKPYKCNECEKAFQTKAILVQHLRIHTGEKPYKCNECGKAFCQSPSLIKHQRIHTGEKPYKCTECGKAFSQSICLTRHQRSHSGDKPFKCNECGKAFNQSACLMQHQRIHSGEKPYTCTECGKAFTQNSSLVEHERTHTGEKLYKCSECEKTFRKQAHLSEHYRIHTGEKPYECVGCGKSFRHSSALLRHQRLHAGE
Protein accession: ENSP00000307556
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00115560-B01-13-15-1.jpg
Application image note: Western Blot analysis of ZNF501 expression in transfected 293T cell line (H00115560-T01) by ZNF501 MaxPab polyclonal antibody.

Lane 1: ZNF501 transfected lysate(28.82 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZNF501 MaxPab mouse polyclonal antibody (B01) now

Add to cart