UHRF2 monoclonal antibody (M01), clone 3A11 View larger

UHRF2 monoclonal antibody (M01), clone 3A11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UHRF2 monoclonal antibody (M01), clone 3A11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about UHRF2 monoclonal antibody (M01), clone 3A11

Brand: Abnova
Reference: H00115426-M01
Product name: UHRF2 monoclonal antibody (M01), clone 3A11
Product description: Mouse monoclonal antibody raised against a partial recombinant UHRF2.
Clone: 3A11
Isotype: IgG2b Kappa
Gene id: 115426
Gene name: UHRF2
Gene alias: DKFZp434B0920|DKFZp686G0837|MGC33463|NIRF|RNF107|URF2
Gene description: ubiquitin-like with PHD and ring finger domains 2
Genbank accession: NM_152896
Immunogen: UHRF2 (NP_690856, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PGTSTQIEAKPCSNSPPKVKKAPRVGPSNQPSTSARARLIDPGFGIYKVNELVDARDVGLGAWFEAHIHSVTRASDGQSRGKTPLKNGSSCKRTNGNIKH
Protein accession: NP_690856
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00115426-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00115426-M01-42-R01V-1.jpg
Application image note: Western blot analysis of UHRF2 over-expressed 293 cell line, cotransfected with UHRF2 Validated Chimera RNAi ( Cat # H00115426-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with UHRF2 monoclonal antibody (M01), clone 3A11 (Cat # H00115426-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Applications: IF,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice

Reviews

Buy UHRF2 monoclonal antibody (M01), clone 3A11 now

Add to cart