UHRF2 polyclonal antibody (A01) View larger

UHRF2 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UHRF2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about UHRF2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00115426-A01
Product name: UHRF2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant UHRF2.
Gene id: 115426
Gene name: UHRF2
Gene alias: DKFZp434B0920|DKFZp686G0837|MGC33463|NIRF|RNF107|URF2
Gene description: ubiquitin-like with PHD and ring finger domains 2
Genbank accession: NM_152896
Immunogen: UHRF2 (NP_690856, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: PGTSTQIEAKPCSNSPPKVKKAPRVGPSNQPSTSARARLIDPGFGIYKVNELVDARDVGLGAWFEAHIHSVTRASDGQSRGKTPLKNGSSCKRTNGNIKH
Protein accession: NP_690856
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00115426-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy UHRF2 polyclonal antibody (A01) now

Add to cart