C7orf30 purified MaxPab mouse polyclonal antibody (B01P) View larger

C7orf30 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C7orf30 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about C7orf30 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00115416-B01P
Product name: C7orf30 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human C7orf30 protein.
Gene id: 115416
Gene name: C7orf30
Gene alias: -
Gene description: chromosome 7 open reading frame 30
Genbank accession: NM_138446
Immunogen: C7orf30 (NP_612455.1, 1 a.a. ~ 234 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGPGGRVARLLAPLMWRRAVSSVAGSAVGAEPGLRLLAVQRLPVGAAFCRACQTPNFVRGLHSEPGLEERAEGTVNEGRPESDAADHTGPKFDIDMMVSLLRQENARDICVIQVPPEMRYTDYFVIVSGTSTRHLHAMAFYVVKMYKHLKCKRDPHVKIEGKDTDDWLCVDFGSMVIHLMLPETREIYELEKLWTLRSYDDQLAQIAPETVPEDFILGIEDDTSSVTPVELKCE
Protein accession: NP_612455.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00115416-B01P-13-15-1.jpg
Application image note: Western Blot analysis of C7orf30 expression in transfected 293T cell line (H00115416-T01) by C7orf30 MaxPab polyclonal antibody.

Lane 1: C7orf30 transfected lysate(25.74 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy C7orf30 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart