RAB42 monoclonal antibody (M03), clone 3A2 View larger

RAB42 monoclonal antibody (M03), clone 3A2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAB42 monoclonal antibody (M03), clone 3A2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,IF,ELISA,WB-Re

More info about RAB42 monoclonal antibody (M03), clone 3A2

Brand: Abnova
Reference: H00115273-M03
Product name: RAB42 monoclonal antibody (M03), clone 3A2
Product description: Mouse monoclonal antibody raised against a partial recombinant RAB42.
Clone: 3A2
Isotype: IgG1 Kappa
Gene id: 115273
Gene name: RAB42
Gene alias: MGC45806|RP4-669K10.6
Gene description: RAB42, member RAS oncogene family
Genbank accession: NM_152304
Immunogen: RAB42 (NP_689517, 46 a.a. ~ 105 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SVKNNCNVDLAFDTLADAIQQALQQGDIKLEEGWGGVRLIHKTQIPRSPSRKQHSGPCQC
Protein accession: NP_689517
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00115273-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.34 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00115273-M03-3-7-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to RAB42 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
Applications: IHC-P,IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RAB42 monoclonal antibody (M03), clone 3A2 now

Add to cart